PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018773P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 338aa    MW: 37593 Da    PI: 5.8537
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018773P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv++++ +G+g+W+  ++  g+ R++k+c++rw +yl
   MELO3C018773P1 14 KGPWTPEEDQKLVNYIQIHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.65e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
   MELO3C018773P1  67 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.143965IPR017930Myb domain
SuperFamilySSF466891.39E-3111108IPR009057Homeodomain-like
SMARTSM007177.1E-151363IPR001005SANT/Myb domain
PfamPF002499.6E-171461IPR001005SANT/Myb domain
CDDcd001674.01E-131661No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.34266116IPR017930Myb domain
SMARTSM007174.8E-1666114IPR001005SANT/Myb domain
PfamPF002492.0E-1567111IPR001005SANT/Myb domain
CDDcd001674.33E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRAPCCDKS GLKKGPWTPE EDQKLVNYIQ IHGPGNWRNL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRI DLLDLSSMLS AAIQSHPLLG LSTLLNNHQT TTTLNPESLR LISTLLSLKQ  180
EDQNAHNLLL QAQAQAQIQA QMDSLSQLLQ PNDNVNNTNS SSVMPISSTF VDCSNTSQEN  240
LNFLPTNLNC GEDVLMNQHN YMYGGDGSNP TASEILDISN NNAQTLGFDS VKSSPTPLNS  300
SSTYLNNSSS NEDEKDSFCS NFLQFEIPEG LDFADFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-31121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-31121162105C-Myb DNA-Binding Domain
1msf_C4e-31121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455362.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A0A0K2930.0A0A0A0K293_CUCSA; Uncharacterized protein
STRINGGLYMA13G37820.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-87MYB-like 102